Frog corticotropin-releasing hormone (CRH): Isolation, molecular cloning, and biological activity

Reiko Okada, Yoichi Ito, Miyoko Kaneko, Kazutoshi Yamamoto, Nicolas Chartrel, J. Michael Conlon, Hubert Vaudry, Sakae Kikuyama

    Research output: Contribution to journalArticle

    12 Citations (Scopus)

    Abstract

    Corticotropin-releasing hormone (CRH) was isolated from the brain of the European green frog, Rana esculenta, by combining HPLC purification with radioimmunoassay (RIA) detection. The amino acid sequence SEEPPISLDLTFHLLREVLEMARAEQIAQQAHSNRKLMDII was identical with the sequence of bullfrog (R. catesbeiana) CRH that was deduced from a cDNA encoding the CRH precursor. Synthetic frog CRH enhanced the release of thyroid-stimulating hormone (TSH) from dispersed bullfrog pituitary cells in a concentration- dependent manner. The TSH-releasing activity of a bullfrog hypothalamic extract was decreased by approximately 45% in the presence of the CRH receptor antagonist, α-helical CRH9-41, suggesting that CRH is one of the main TSH-releasing factors present in the bullfrog hypothalamus.

    Original languageEnglish
    Pages (from-to)150-155
    Number of pages6
    JournalAnnals of the New York Academy of Sciences
    Volume1040
    DOIs
    Publication statusPublished - 2005

    Keywords

    • Bullfrog
    • CRH
    • TSH
    • TSH-releasing factor

    ASJC Scopus subject areas

    • Biochemistry, Genetics and Molecular Biology(all)
    • History and Philosophy of Science

    Fingerprint Dive into the research topics of 'Frog corticotropin-releasing hormone (CRH): Isolation, molecular cloning, and biological activity'. Together they form a unique fingerprint.

  • Cite this

    Okada, R., Ito, Y., Kaneko, M., Yamamoto, K., Chartrel, N., Conlon, J. M., Vaudry, H., & Kikuyama, S. (2005). Frog corticotropin-releasing hormone (CRH): Isolation, molecular cloning, and biological activity. Annals of the New York Academy of Sciences, 1040, 150-155. https://doi.org/10.1196/annals.1327.019