Frog corticotropin-releasing hormone (CRH): Isolation, molecular cloning, and biological activity

Reiko Okada, Yoichi Ito, Miyoko Kaneko, Kazutoshi Yamamoto, Nicolas Chartrel, J. Michael Conlon, Hubert Vaudry, Sakae Kikuyama

    Research output: Contribution to journalArticle

    12 Citations (Scopus)

    Abstract

    Corticotropin-releasing hormone (CRH) was isolated from the brain of the European green frog, Rana esculenta, by combining HPLC purification with radioimmunoassay (RIA) detection. The amino acid sequence SEEPPISLDLTFHLLREVLEMARAEQIAQQAHSNRKLMDII was identical with the sequence of bullfrog (R. catesbeiana) CRH that was deduced from a cDNA encoding the CRH precursor. Synthetic frog CRH enhanced the release of thyroid-stimulating hormone (TSH) from dispersed bullfrog pituitary cells in a concentration- dependent manner. The TSH-releasing activity of a bullfrog hypothalamic extract was decreased by approximately 45% in the presence of the CRH receptor antagonist, α-helical CRH9-41, suggesting that CRH is one of the main TSH-releasing factors present in the bullfrog hypothalamus.

    Original languageEnglish
    Pages (from-to)150-155
    Number of pages6
    JournalAnnals of the New York Academy of Sciences
    Volume1040
    DOIs
    Publication statusPublished - 2005

    Fingerprint

    Cloning
    Corticotropin-Releasing Hormone
    Molecular Cloning
    Rana catesbeiana
    Bioactivity
    Anura
    Thyrotropin
    Rana clamitans
    Rana esculenta
    Corticotropin-Releasing Hormone Receptors
    Hormone Antagonists
    Hypothalamus
    Radioimmunoassay
    Purification
    Amino Acid Sequence
    Brain
    Complementary DNA
    High Pressure Liquid Chromatography
    Hormones
    Isolation

    Keywords

    • Bullfrog
    • CRH
    • TSH
    • TSH-releasing factor

    ASJC Scopus subject areas

    • Biochemistry, Genetics and Molecular Biology(all)
    • History and Philosophy of Science

    Cite this

    Okada, R., Ito, Y., Kaneko, M., Yamamoto, K., Chartrel, N., Conlon, J. M., ... Kikuyama, S. (2005). Frog corticotropin-releasing hormone (CRH): Isolation, molecular cloning, and biological activity. Annals of the New York Academy of Sciences, 1040, 150-155. https://doi.org/10.1196/annals.1327.019

    Frog corticotropin-releasing hormone (CRH) : Isolation, molecular cloning, and biological activity. / Okada, Reiko; Ito, Yoichi; Kaneko, Miyoko; Yamamoto, Kazutoshi; Chartrel, Nicolas; Conlon, J. Michael; Vaudry, Hubert; Kikuyama, Sakae.

    In: Annals of the New York Academy of Sciences, Vol. 1040, 2005, p. 150-155.

    Research output: Contribution to journalArticle

    Okada, R, Ito, Y, Kaneko, M, Yamamoto, K, Chartrel, N, Conlon, JM, Vaudry, H & Kikuyama, S 2005, 'Frog corticotropin-releasing hormone (CRH): Isolation, molecular cloning, and biological activity', Annals of the New York Academy of Sciences, vol. 1040, pp. 150-155. https://doi.org/10.1196/annals.1327.019
    Okada, Reiko ; Ito, Yoichi ; Kaneko, Miyoko ; Yamamoto, Kazutoshi ; Chartrel, Nicolas ; Conlon, J. Michael ; Vaudry, Hubert ; Kikuyama, Sakae. / Frog corticotropin-releasing hormone (CRH) : Isolation, molecular cloning, and biological activity. In: Annals of the New York Academy of Sciences. 2005 ; Vol. 1040. pp. 150-155.
    @article{5fe52c9f817b481babdf62703fe87752,
    title = "Frog corticotropin-releasing hormone (CRH): Isolation, molecular cloning, and biological activity",
    abstract = "Corticotropin-releasing hormone (CRH) was isolated from the brain of the European green frog, Rana esculenta, by combining HPLC purification with radioimmunoassay (RIA) detection. The amino acid sequence SEEPPISLDLTFHLLREVLEMARAEQIAQQAHSNRKLMDII was identical with the sequence of bullfrog (R. catesbeiana) CRH that was deduced from a cDNA encoding the CRH precursor. Synthetic frog CRH enhanced the release of thyroid-stimulating hormone (TSH) from dispersed bullfrog pituitary cells in a concentration- dependent manner. The TSH-releasing activity of a bullfrog hypothalamic extract was decreased by approximately 45{\%} in the presence of the CRH receptor antagonist, α-helical CRH9-41, suggesting that CRH is one of the main TSH-releasing factors present in the bullfrog hypothalamus.",
    keywords = "Bullfrog, CRH, TSH, TSH-releasing factor",
    author = "Reiko Okada and Yoichi Ito and Miyoko Kaneko and Kazutoshi Yamamoto and Nicolas Chartrel and Conlon, {J. Michael} and Hubert Vaudry and Sakae Kikuyama",
    year = "2005",
    doi = "10.1196/annals.1327.019",
    language = "English",
    volume = "1040",
    pages = "150--155",
    journal = "Annals of the New York Academy of Sciences",
    issn = "0077-8923",
    publisher = "Wiley-Blackwell",

    }

    TY - JOUR

    T1 - Frog corticotropin-releasing hormone (CRH)

    T2 - Isolation, molecular cloning, and biological activity

    AU - Okada, Reiko

    AU - Ito, Yoichi

    AU - Kaneko, Miyoko

    AU - Yamamoto, Kazutoshi

    AU - Chartrel, Nicolas

    AU - Conlon, J. Michael

    AU - Vaudry, Hubert

    AU - Kikuyama, Sakae

    PY - 2005

    Y1 - 2005

    N2 - Corticotropin-releasing hormone (CRH) was isolated from the brain of the European green frog, Rana esculenta, by combining HPLC purification with radioimmunoassay (RIA) detection. The amino acid sequence SEEPPISLDLTFHLLREVLEMARAEQIAQQAHSNRKLMDII was identical with the sequence of bullfrog (R. catesbeiana) CRH that was deduced from a cDNA encoding the CRH precursor. Synthetic frog CRH enhanced the release of thyroid-stimulating hormone (TSH) from dispersed bullfrog pituitary cells in a concentration- dependent manner. The TSH-releasing activity of a bullfrog hypothalamic extract was decreased by approximately 45% in the presence of the CRH receptor antagonist, α-helical CRH9-41, suggesting that CRH is one of the main TSH-releasing factors present in the bullfrog hypothalamus.

    AB - Corticotropin-releasing hormone (CRH) was isolated from the brain of the European green frog, Rana esculenta, by combining HPLC purification with radioimmunoassay (RIA) detection. The amino acid sequence SEEPPISLDLTFHLLREVLEMARAEQIAQQAHSNRKLMDII was identical with the sequence of bullfrog (R. catesbeiana) CRH that was deduced from a cDNA encoding the CRH precursor. Synthetic frog CRH enhanced the release of thyroid-stimulating hormone (TSH) from dispersed bullfrog pituitary cells in a concentration- dependent manner. The TSH-releasing activity of a bullfrog hypothalamic extract was decreased by approximately 45% in the presence of the CRH receptor antagonist, α-helical CRH9-41, suggesting that CRH is one of the main TSH-releasing factors present in the bullfrog hypothalamus.

    KW - Bullfrog

    KW - CRH

    KW - TSH

    KW - TSH-releasing factor

    UR - http://www.scopus.com/inward/record.url?scp=22144452864&partnerID=8YFLogxK

    UR - http://www.scopus.com/inward/citedby.url?scp=22144452864&partnerID=8YFLogxK

    U2 - 10.1196/annals.1327.019

    DO - 10.1196/annals.1327.019

    M3 - Article

    C2 - 15891019

    AN - SCOPUS:22144452864

    VL - 1040

    SP - 150

    EP - 155

    JO - Annals of the New York Academy of Sciences

    JF - Annals of the New York Academy of Sciences

    SN - 0077-8923

    ER -